GFAP (NM_002055) Human Mass Spec Standard
CAT#: PH304548
GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046)
View other "GFAP" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GFAP MS Standard C13 and N15-labeled recombinant protein (NP_002046) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204548 |
Predicted MW | 49.9 kDa |
Protein Sequence |
>RC204548 protein sequence
Red=Cloning site Green=Tags(s) MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRVDFSLAGALNAGFKETRASER AEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVE RDNLAQDLATVRQKLQDETNLRLEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVRE LQEQLARQQVHVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELLRQAKH EANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQ DLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEV IKESKQEHKDVM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002046 |
RefSeq Size | 3097 |
RefSeq ORF | 1296 |
Synonyms | ALXDRD |
Locus ID | 2670 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008] |
Protein Families | ES Cell Differentiation/IPS |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419563 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427360 | GFAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419563 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 1 |
CNY 3,080.00 |
|
LY427360 | Transient overexpression lysate of glial fibrillary acidic protein (GFAP), transcript variant 2 |
CNY 3,080.00 |
|
TP304548 | Recombinant protein of human glial fibrillary acidic protein (GFAP), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP762317 | Purified recombinant protein of Human glial fibrillary acidic protein (GFAP), transcript variant 1, Leu292-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |