CENPH (NM_022909) Human Mass Spec Standard
CAT#: PH304531
CENPH MS Standard C13 and N15-labeled recombinant protein (NP_075060)
View other "CENPH" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CENPH MS Standard C13 and N15-labeled recombinant protein (NP_075060) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204531 |
Predicted MW | 28.5 kDa |
Protein Sequence |
>RC204531 protein sequence
Red=Cloning site Green=Tags(s) MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPE QIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLI MKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITT VIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_075060 |
RefSeq Size | 1405 |
RefSeq ORF | 741 |
Locus ID | 64946 |
Cytogenetics | 5q13.2 |
Summary | Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402956 | CENPH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402956 | Transient overexpression lysate of centromere protein H (CENPH) |
CNY 3,080.00 |
|
TP304531 | Recombinant protein of human centromere protein H (CENPH), 20 µg |
CNY 2,900.00 |