BCL2 (NM_000633) Human Mass Spec Standard
CAT#: PH304498
BCL2 MS Standard C13 and N15-labeled recombinant protein (NP_000624)
View other "BCL2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | BCL2 MS Standard C13 and N15-labeled recombinant protein (NP_000624) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204498 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC204498 representing NM_000633
Red=Cloning site Green=Tags(s) MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTS PLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD GVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLF DFSWLSLKTLLSLALVGACITLGAYLGHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000624 |
RefSeq Size | 6492 |
RefSeq ORF | 717 |
Synonyms | Bcl-2; PPP1R50 |
Locus ID | 596 |
Cytogenetics | 18q21.33 |
Summary | This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Focal adhesion, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424584 | BCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424602 | BCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424584 | Transient overexpression lysate of B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant beta |
CNY 3,080.00 |
|
LY424602 | Transient overexpression lysate of B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha |
CNY 3,080.00 |
|
TP304498 | Recombinant protein of human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
TP750159 | Purified recombinant protein of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha,Met1-Lys218, with C-terminal His tag, expressed in E. coli, 50ug |
CNY 1,948.00 |
|
TP762352 | Purified recombinant protein of Human B-cell CLL/lymphoma 2 (BCL2), nuclear gene encoding mitochondrial protein, transcript variant alpha, Gly54-Val66(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |