TAK1 (MAP3K7) (NM_003188) Human Mass Spec Standard
CAT#: PH304454
MAP3K7 MS Standard C13 and N15-labeled recombinant protein (NP_003179)
View other "TAK1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MAP3K7 MS Standard C13 and N15-labeled recombinant protein (NP_003179) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204454 |
Predicted MW | 64 kDa |
Protein Sequence |
>RC204454 representing NM_003188
Red=Cloning site Green=Tags(s) MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE RKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQG VAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKC DVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEI VKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG TEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSK ESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQ CKKQLEVIRSQQQKRQGTS TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003179 |
RefSeq Size | 2912 |
RefSeq ORF | 1737 |
Synonyms | CSCF; FMD2; MEKK7; TAK1; TGF1a |
Locus ID | 6885 |
Cytogenetics | 6q15 |
Summary | The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adherens junction, MAPK signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407927 | MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC407928 | MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418841 | MAP3K7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407927 | Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant B |
CNY 4,840.00 |
|
LY407928 | Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant C |
CNY 4,840.00 |
|
LY418841 | Transient overexpression lysate of mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant A |
CNY 3,080.00 |
|
TP304454 | Recombinant protein of human mitogen-activated protein kinase kinase kinase 7 (MAP3K7), transcript variant A, 20 µg |
CNY 2,900.00 |