United States
Germany
Japan
United Kingdom
China
CD34 (NM_001025109) Human Mass Spec Standard
CAT＃: PH304446
CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280)
View other "CD34" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | CD34 MS Standard C13 and N15-labeled recombinant protein (NP_001020280) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204446 |
| Predicted MW | 40.7 kDa |
| Protein Sequence |
>RC204446 protein sequence
Red=Cloning site Green=Tags(s) MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020280 |
| RefSeq Size | 2621 |
| RefSeq ORF | 1155 |
| Locus ID | 947 |
| Cytogenetics | 1q32.2 |
| Summary | The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Adult stem cells, Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400668 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422593 | CD34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400668 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 2 |
CNY 3,080.00 |
|
| LY422593 | Transient overexpression lysate of CD34 molecule (CD34), transcript variant 1 |
CNY 3,080.00 |
|
| TP304446 | Recombinant protein of human CD34 molecule (CD34), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP700209 | Recombinant protein of human CD34 molecule (CD34), transcript variant 2, extracellular domain with C-terminal Fc fusion, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP724005 | Human CD34 Protein, His Tag |
CNY 4,925.00 |
|
| TP762681 | Purified recombinant protein of Human CD34 molecule (CD34), transcript variant 1, 32Ser-290Thr, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |
