BAX (NM_138761) Human Mass Spec Standard
CAT#: PH304369
BAX MS Standard C13 and N15-labeled recombinant protein (NP_620116)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | BAX MS Standard C13 and N15-labeled recombinant protein (NP_620116) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204369 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC204369 representing NM_138761
Red=Cloning site Green=Tags(s) MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620116 |
RefSeq Size | 888 |
RefSeq ORF | 576 |
Synonyms | BCL2L4 |
Locus ID | 581 |
Cytogenetics | 19q13.33 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Dec 2019] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Huntington's disease, Neurotrophin signaling pathway, p53 signaling pathway, Pathways in cancer, Prion diseases |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408504 | BAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408505 | BAX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408504 | Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant alpha |
CNY 3,080.00 |
|
LY408505 | Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant delta |
CNY 3,080.00 |
|
TP304369 | Purified recombinant protein of Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
TP750152 | Purified recombinant protein of Human BCL2-associated X protein (BAX), transcript variant alpha, Met1-Gln171, with C-terminal HIS tag, expressed in E.Coli, 50 ug |
CNY 2,040.00 |