G protein alpha Inhibitor 2 (GNAI2) (NM_002070) Human Mass Spec Standard
CAT#: PH304215
GNAI2 MS Standard C13 and N15-labeled recombinant protein (NP_002061)
View other "G protein alpha Inhibitor 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GNAI2 MS Standard C13 and N15-labeled recombinant protein (NP_002061) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204215 |
Predicted MW | 40.5 kDa |
Protein Sequence |
>RC204215 protein sequence
Red=Cloning site Green=Tags(s) MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK DCGLF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002061 |
RefSeq Size | 2258 |
RefSeq ORF | 1065 |
Synonyms | GIP; GNAI2B; H_LUCA15.1; H_LUCA16.1 |
Locus ID | 2771 |
Cytogenetics | 3p21.31 |
Summary | The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400760 | GNAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400760 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), transcript variant 1 |
CNY 3,080.00 |
|
TP304215 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 (GNAI2), 20 µg |
CNY 2,900.00 |
其它G protein alpha Inhibitor 2产品