Claudin 2 (CLDN2) (NM_020384) Human Mass Spec Standard
CAT#: PH304199
CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117)
View other "Claudin 2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLDN2 MS Standard C13 and N15-labeled recombinant protein (NP_065117) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204199 |
Predicted MW | 24.5 kDa |
Protein Sequence |
>RC204199 protein sequence
Red=Cloning site Green=Tags(s) MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR PGQPPKVKSEFNSYSLTGYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065117 |
RefSeq Size | 2998 |
RefSeq ORF | 690 |
Synonyms | OAZON |
Locus ID | 9075 |
Cytogenetics | Xq22.3 |
Summary | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.[provided by RefSeq, Jan 2010] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402780 | CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432728 | CLDN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402780 | Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 1 |
CNY 3,080.00 |
|
LY432728 | Transient overexpression lysate of claudin 2 (CLDN2), transcript variant 2 |
CNY 3,080.00 |
|
TP304199 | Recombinant protein of human claudin 2 (CLDN2), 20 µg |
CNY 2,900.00 |
其它Claudin 2产品