CD43 (SPN) (NM_003123) Human Mass Spec Standard
CAT#: PH304195
SPN MS Standard C13 and N15-labeled recombinant protein (NP_003114)
View other "CD43" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SPN MS Standard C13 and N15-labeled recombinant protein (NP_003114) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204195 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC204195 protein sequence
Red=Cloning site Green=Tags(s) MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTS INEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSP ETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTG SLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRR QKRRTGALVLSRGGKRNGVVDAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRK SRQGSLAMEELKSGSGPSLKGEEEPLVASEDGAVDAPAPDEPEGGDGAAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003114 |
RefSeq Size | 6911 |
RefSeq ORF | 1200 |
Synonyms | CD43; GALGP; GPL115; LSN |
Locus ID | 6693 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular domain, a transmembrane region and a carboxy-terminal intracellular region. The extracellular domain has a high proportion of serine and threonine residues, allowing extensive O-glycosylation, and has one potential N-glycosylation site, while the carboxy-terminal region has potential phosphorylation sites that may mediate transduction of activation signals. Different glycoforms of this protein have been described. In stimulated immune cells, proteolytic cleavage of the extracellular domain occurs in some cell types, releasing a soluble extracellular fragment. Defects in expression of this gene are associated with Wiskott-Aldrich syndrome. [provided by RefSeq, Sep 2017] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs) |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418888 | SPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422249 | SPN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418888 | Transient overexpression lysate of sialophorin (SPN), transcript variant 2 |
CNY 3,080.00 |
|
LY422249 | Transient overexpression lysate of sialophorin (SPN), transcript variant 1 |
CNY 3,080.00 |
|
TP304195 | Recombinant protein of human sialophorin (SPN), transcript variant 2, 20 µg |
CNY 2,900.00 |