Rad6 (UBE2A) (NM_003336) Human Mass Spec Standard
CAT#: PH304194
UBE2A MS Standard C13 and N15-labeled recombinant protein (NP_003327)
View other "Rad6" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | UBE2A MS Standard C13 and N15-labeled recombinant protein (NP_003327) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204194 |
Predicted MW | 17.3 kDa |
Protein Sequence |
>RC204194 protein sequence
Red=Cloning site Green=Tags(s) MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTV RFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR VSAIVEQSWRDC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003327 |
RefSeq Size | 1878 |
RefSeq ORF | 456 |
Synonyms | HHR6A; MRXS30; MRXSN; RAD6A; UBC2 |
Locus ID | 7319 |
Cytogenetics | Xq24 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair, and may play a role in transcriptional regulation. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418754 | UBE2A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418754 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1 |
CN¥ 3,080.00 |
|
TP304194 | Recombinant protein of human ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP720160 | Recombinant protein of human ubiquitin-conjugating enzyme E2A (RAD6 homolog) (UBE2A), transcript variant 1 |
CN¥ 1,800.00 |