IGFBP4 (NM_001552) Human Mass Spec Standard
CAT#: PH304188
IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543)
View other "IGFBP4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204188 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC204188 protein sequence
Red=Cloning site Green=Tags(s) MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001543 |
RefSeq Size | 2246 |
RefSeq ORF | 774 |
Synonyms | BP-4; HT29-IGFBP; IBP4; IGFBP-4 |
Locus ID | 3487 |
Cytogenetics | 17q21.2 |
Summary | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419861 | IGFBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419861 | Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4) |
CNY 3,080.00 |
|
TP304188 | Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 20 µg |
CNY 2,900.00 |
|
TP720301 | Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4) |
CNY 3,140.00 |