United States
Germany
Japan
United Kingdom
China
Midkine (MDK) (NM_001012333) Human Mass Spec Standard
CAT＃: PH303995
MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333)
View other "Midkine" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203995 |
| Predicted MW | 15.6 kDa |
| Protein Sequence |
>RC203995 protein sequence
Red=Cloning site Green=Tags(s) MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK GKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001012333 |
| RefSeq Size | 969 |
| RefSeq ORF | 429 |
| Synonyms | ARAP; MK; NEGF2 |
| Locus ID | 4192 |
| Cytogenetics | 11p11.2 |
| Summary | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419358 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423327 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423328 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425316 | MDK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419358 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3 |
CNY 3,080.00 |
|
| LY423327 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2 |
CNY 3,080.00 |
|
| LY423328 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
CNY 3,080.00 |
|
| LY425316 | Transient overexpression lysate of midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1 |
CNY 3,080.00 |
|
| PH313133 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_002382) |
CNY 19,520.00 |
|
| PH321818 | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012334) |
CNY 14,250.00 |
|
| TP303995 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP313133 | Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP321818 | Purified recombinant protein of Homo sapiens midkine (neurite growth-promoting factor 2) (MDK), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Midkine产品
