RAB3A (NM_002866) Human Mass Spec Standard
CAT#: PH303973
RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857)
View other "RAB3A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RAB3A MS Standard C13 and N15-labeled recombinant protein (NP_002857) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203973 |
Predicted MW | 25 kDa |
Protein Sequence |
>RC203973 protein sequence
Red=Cloning site Green=Tags(s) MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKR IKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDME DERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQ QVPPHQDCAC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002857 |
RefSeq Size | 1528 |
RefSeq ORF | 660 |
Locus ID | 5864 |
Cytogenetics | 19p13.11 |
Summary | Small GTP-binding protein that plays a central role in regulated exocytosis and secretion. Controls the recruitment, tethering and docking of secretory vesicles to the plasma membrane (By similarity). Upon stimulation, switches to its active GTP-bound form, cycles to vesicles and recruits effectors such as RIMS1, RIMS2, Rabphilin-3A/RPH3A, RPH3AL or SYTL4 to help the docking of vesicules onto the plasma membrane (By similarity). Upon GTP hydrolysis by GTPase-activating protein, dissociates from the vesicle membrane allowing the exocytosis to proceed (By similarity). Stimulates insulin secretion through interaction with RIMS2 or RPH3AL effectors in pancreatic beta cells (By similarity). Regulates calcium-dependent lysosome exocytosis and plasma membrane repair (PMR) via the interaction with 2 effectors, SYTL4 and myosin-9/MYH9 (PubMed:27325790). Acts as a positive regulator of acrosome content secretion in sperm cells by interacting with RIMS1 (PubMed:22248876, PubMed:30599141). Plays also a role in the regulation of dopamine release by interacting with synaptotagmin I/SYT (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419059 | RAB3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419059 | Transient overexpression lysate of RAB3A, member RAS oncogene family (RAB3A) |
CNY 3,080.00 |
|
TP303973 | Recombinant protein of human RAB3A, member RAS oncogene family (RAB3A), 20 µg |
CNY 2,900.00 |