NHLH1 (NM_005598) Human Mass Spec Standard
CAT#: PH303893
NHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_005589)
View other "NHLH1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_005589) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203893 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC203893 protein sequence
Red=Cloning site Green=Tags(s) MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005589 |
RefSeq Size | 2594 |
RefSeq ORF | 399 |
Synonyms | bHLHa35; HEN1; NSCL; NSCL1 |
Locus ID | 4807 |
Cytogenetics | 1q23.2 |
Summary | The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM, Nov 2002] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401716 | NHLH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401716 | Transient overexpression lysate of nescient helix loop helix 1 (NHLH1) |
CNY 3,080.00 |
|
TP303893 | Recombinant protein of human nescient helix loop helix 1 (NHLH1), 20 µg |
CNY 2,900.00 |