Stefin B (CSTB) (NM_000100) Human Mass Spec Standard
CAT#: PH303872
CSTB MS Standard C13 and N15-labeled recombinant protein (NP_000091)
View other "Stefin B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CSTB MS Standard C13 and N15-labeled recombinant protein (NP_000091) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203872 |
Predicted MW | 11.1 kDa |
Protein Sequence |
>RC203872 protein sequence
Red=Cloning site Green=Tags(s) MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF QSLPHENKPLTLSNYQTNKAKHDELTYF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000091 |
RefSeq Size | 940 |
RefSeq ORF | 294 |
Synonyms | CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD |
Locus ID | 1476 |
Cytogenetics | 21q22.3 |
Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424918 | CSTB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424918 | Transient overexpression lysate of cystatin B (stefin B) (CSTB) |
CNY 3,080.00 |
|
TP303872 | Recombinant protein of human cystatin B (stefin B) (CSTB), 20 µg |
CNY 2,900.00 |
其它Stefin B产品