Integrin beta 1 (ITGB1) (NM_002211) Human Mass Spec Standard
CAT#: PH303818
ITGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002202)
View other "Integrin beta 1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ITGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002202) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203818 |
Predicted MW | 88.4 kDa |
Protein Sequence |
>RC203818 protein sequence
Red=Cloning site Green=Tags(s) MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEAL KKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAED YPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSE QNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDA GFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKN LIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACR CNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNC DRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTC EMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCW FYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEK MNAKWDTGENPIYKSAVTTVVNPKYEGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002202 |
RefSeq Size | 3879 |
RefSeq ORF | 2394 |
Synonyms | CD29; FNRB; GPIIA; MDF2; MSK12; VLA-BETA; VLAB |
Locus ID | 3688 |
Cytogenetics | 10p11.22 |
Summary | Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Axon guidance, Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400805 | ITGB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408839 | ITGB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC409466 | ITGB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400805 | Transient overexpression lysate of integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A |
CNY 3,080.00 |
|
LY408839 | Transient overexpression lysate of integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1E |
CNY 4,840.00 |
|
LY409466 | Transient overexpression lysate of integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1D |
CNY 4,840.00 |
|
PH315247 | ITGB1 MS Standard C13 and N15-labeled recombinant protein (NP_596867) |
CNY 19,520.00 |
|
TP303818 | Recombinant protein of human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1A, 20 µg |
CNY 2,900.00 |
|
TP315247 | Recombinant protein of human integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12) (ITGB1), transcript variant 1E, 20 µg |
CNY 2,900.00 |
其它Integrin beta 1产品