HSD17B8 (NM_014234) Human Mass Spec Standard
CAT#: PH303806
HSD17B8 MS Standard C13 and N15-labeled recombinant protein (NP_055049)
View other "HSD17B8" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HSD17B8 MS Standard C13 and N15-labeled recombinant protein (NP_055049) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203806 |
Predicted MW | 27 kDa |
Protein Sequence |
>RC203806 protein sequence
Red=Cloning site Green=Tags(s) MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHA AFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQ ALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKV PQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055049 |
RefSeq Size | 1002 |
RefSeq ORF | 783 |
Synonyms | D6S2245E; dJ1033B10.9; FABG; FABGL; H2-KE6; HKE6; KE6; RING2; SDR30C1 |
Locus ID | 7923 |
Cytogenetics | 6p21.32 |
Summary | In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Androgen and estrogen metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415425 | HSD17B8 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY415425 | Transient overexpression lysate of hydroxysteroid (17-beta) dehydrogenase 8 (HSD17B8) |
CN¥ 3,080.00 |
|
TP303806 | Recombinant protein of human hydroxysteroid (17-beta) dehydrogenase 8 (HSD17B8), 20 µg |
CN¥ 2,900.00 |
其它HSD17B8产品