EWSR1 (NM_005243) Human Mass Spec Standard
CAT#: PH303709
EWSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005234)
View other "EWSR1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 3,490.00
Specifications
Product Data | |
Description | EWSR1 MS Standard C13 and N15-labeled recombinant protein (NP_005234) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203709 |
Predicted MW | 68.4 kDa |
Protein Sequence |
>RC203709 protein sequence
Red=Cloning site Green=Tags(s) MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSY GQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQ DGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQ QNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQ ESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGERGGFNKPGGPMDEGPDLDLGPP VDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPP TAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRG GDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGG DRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGG RRGGRGGPGKMDKGEHRQERRDRPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005234 |
RefSeq Size | 2679 |
RefSeq ORF | 1965 |
Synonyms | bK984G1.4; EWS; EWS-FLI1 |
Locus ID | 2130 |
Cytogenetics | 22q12.2 |
Summary | This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401610 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431514 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432342 | EWSR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401610 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 2 |
CNY 3,080.00 |
|
LY431514 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 4 |
CNY 3,080.00 |
|
LY432342 | Transient overexpression lysate of Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant 1 |
CNY 3,080.00 |
|
TP303709 | Recombinant protein of human Ewing sarcoma breakpoint region 1 (EWSR1), transcript variant EWS, 20 µg |
CNY 2,900.00 |