RERG (NM_032918) Human Mass Spec Standard
CAT#: PH303564
RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307)
View other "RERG" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RERG MS Standard C13 and N15-labeled recombinant protein (NP_116307) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203564 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC203564 protein sequence
Red=Cloning site Green=Tags(s) MAKSAEVKLAIFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQATIDDEVVSMEILDTAGQEDTIQR EGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNKADLDHSRQVSTEEGEKLATEL ACAFYECSACTGEGNITEIFYELCREVRRRRMVQGKTRRRSSTTHVKQAINKMLTKISS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116307 |
RefSeq Size | 2325 |
RefSeq ORF | 597 |
Locus ID | 85004 |
Cytogenetics | 12p12.3 |
Summary | RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation (Finlin et al., 2001 [PubMed 11533059]).[supplied by OMIM, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409869 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434024 | RERG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409869 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG) |
CNY 3,080.00 |
|
LY434024 | Transient overexpression lysate of RAS-like, estrogen-regulated, growth inhibitor (RERG), transcript variant 2 |
CNY 3,080.00 |
|
TP303564 | Recombinant protein of human RAS-like, estrogen-regulated, growth inhibitor (RERG), 20 µg |
CNY 2,900.00 |