TAF11 (NM_005643) Human Mass Spec Standard
CAT#: PH303466
TAF11 MS Standard C13 and N15-labeled recombinant protein (NP_005634)
View other "TAF11" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | TAF11 MS Standard C13 and N15-labeled recombinant protein (NP_005634) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203466 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC203466 protein sequence
Red=Cloning site Green=Tags(s) MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVE REDSSLLNPAAKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQS ITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF F myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005634 |
RefSeq Size | 1587 |
RefSeq ORF | 633 |
Synonyms | MGC:15243; PRO2134; TAF2I; TAFII28 |
Locus ID | 6882 |
Cytogenetics | 6p21.31 |
Summary | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit of TFIID that is present in all TFIID complexes and interacts with TBP. This subunit also interacts with another small subunit, TAF13, to form a heterodimer with a structure similar to the histone core structure. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417174 | TAF11 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY417174 | Transient overexpression lysate of TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa (TAF11) |
CN¥ 3,080.00 |
|
TP303466 | Recombinant protein of human TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa (TAF11), 20 µg |
CN¥ 2,900.00 |