DCUN1D1 (NM_020640) Human Mass Spec Standard
CAT#: PH303427
DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691)
View other "DCUN1D1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203427 |
Predicted MW | 30.1 kDa |
Protein Sequence |
>RC203427 protein sequence
Red=Cloning site Green=Tags(s) MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065691 |
RefSeq Size | 3192 |
RefSeq ORF | 777 |
Synonyms | DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3 |
Locus ID | 54165 |
Cytogenetics | 3q26.33 |
Summary | Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity (PubMed:25349211, PubMed:28581483). Acts also as an oncogene facilitating malignant transformation and carcinogenic progression (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402796 | DCUN1D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402796 | Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1) |
CNY 3,080.00 |
|
TP303427 | Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1), 20 µg |
CNY 2,900.00 |
|
TP720243 | Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1) |
CNY 1,800.00 |
其它DCUN1D1产品