Destrin (DSTN) (NM_006870) Human Mass Spec Standard
CAT#: PH303419
DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861)
View other "Destrin" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | DSTN MS Standard C13 and N15-labeled recombinant protein (NP_006861) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203419 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC203419 protein sequence
Red=Cloning site Green=Tags(s) MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKH FVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGP EDLNRACIAEKLGGSLIVAFEGCPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006861 |
RefSeq Size | 1614 |
RefSeq ORF | 495 |
Synonyms | ACTDP; ADF; bA462D18.2; HEL32 |
Locus ID | 11034 |
Cytogenetics | 20p12.1 |
Summary | The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402051 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423272 | DSTN HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402051 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 1 |
CN¥ 3,080.00 |
|
LY423272 | Transient overexpression lysate of destrin (actin depolymerizing factor) (DSTN), transcript variant 2 |
CN¥ 3,080.00 |
|
TP303419 | Recombinant protein of human destrin (actin depolymerizing factor) (DSTN), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
其它Destrin产品