CTDSP1 (NM_182642) Human Mass Spec Standard
CAT#: PH303408
CTDSP1 MS Standard C13 and N15-labeled recombinant protein (NP_872580)
View other "CTDSP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CTDSP1 MS Standard C13 and N15-labeled recombinant protein (NP_872580) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203408 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC203408 protein sequence
Red=Cloning site Green=Tags(s) MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAI PKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQ RMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPA SYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872580 |
RefSeq Size | 2652 |
RefSeq ORF | 783 |
Synonyms | NIF3; NLI-IF; NLIIF; SCP1 |
Locus ID | 58190 |
Cytogenetics | 2q35 |
Summary | This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats of the C-terminal domain of RNA polymerase II. The encoded protein plays a role in neuronal gene silencing in non-neuronal cells, and may also inhibit osteoblast differentiation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403640 | CTDSP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412037 | CTDSP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403640 | Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 2 |
CNY 3,080.00 |
|
LY412037 | Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 1 |
CNY 3,080.00 |
|
PH312037 | CTDSP1 MS Standard C13 and N15-labeled recombinant protein (NP_067021) |
CNY 19,520.00 |
|
TP303408 | Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP312037 | Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 (CTDSP1), transcript variant 1, 20 µg |
CNY 2,900.00 |