SPHK1 (NM_021972) Human Mass Spec Standard
CAT#: PH303398
SPHK1 MS Standard C13 and N15-labeled recombinant protein (NP_068807)
View other "SPHK1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | SPHK1 MS Standard C13 and N15-labeled recombinant protein (NP_068807) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203398 |
Predicted MW | 43.9 kDa |
Protein Sequence |
>RC203398 protein sequence
Red=Cloning site Green=Tags(s) MDPVVGCGRGLFGFVFSAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTER RNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGY EQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGT FLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLVLALLHS HLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKG VFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQMPPPEEPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068807 |
RefSeq Size | 1881 |
RefSeq ORF | 1194 |
Synonyms | SPHK |
Locus ID | 8877 |
Cytogenetics | 17q25.1 |
Summary | The protein encoded by this gene catalyzes the phosphorylation of sphingosine to form sphingosine-1-phosphate (S1P), a lipid mediator with both intra- and extracellular functions. Intracellularly, S1P regulates proliferation and survival, and extracellularly, it is a ligand for cell surface G protein-coupled receptors. This protein, and its product S1P, play a key role in TNF-alpha signaling and the NF-kappa-B activation pathway important in inflammatory, antiapoptotic, and immune processes. Phosphorylation of this protein alters its catalytic activity and promotes its translocation to the plasma membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Calcium signaling pathway, Fc gamma R-mediated phagocytosis, Metabolic pathways, Sphingolipid metabolism, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405282 | SPHK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411847 | SPHK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405282 | Transient overexpression lysate of sphingosine kinase 1 (SPHK1), transcript variant 2 |
CNY 3,080.00 |
|
LY411847 | Transient overexpression lysate of sphingosine kinase 1 (SPHK1), transcript variant 1 |
CNY 3,080.00 |
|
TP303398 | Recombinant protein of human sphingosine kinase 1 (SPHK1), transcript variant 1, 20 µg |
CNY 2,900.00 |