Lin28 (LIN28A) (NM_024674) Human Mass Spec Standard
CAT#: PH303397
LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950)
View other "Lin28" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | LIN28A MS Standard C13 and N15-labeled recombinant protein (NP_078950) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203397 |
Predicted MW | 22.7 kDa |
Protein Sequence |
>RC203397 protein sequence
Red=Cloning site Green=Tags(s) MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCY NCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_078950 |
RefSeq Size | 4014 |
RefSeq ORF | 627 |
Synonyms | CSDD1; LIN-28; lin-28A; LIN28; ZCCHC1 |
Locus ID | 79727 |
Cytogenetics | 1p36.11 |
Summary | This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. [provided by RefSeq, Sep 2015] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411135 | LIN28A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY411135 | Transient overexpression lysate of lin-28 homolog (LIN28) |
CN¥ 3,080.00 |
|
TP303397 | Purified recombinant protein of Homo sapiens lin-28 homolog (LIN28), 20 µg |
CN¥ 2,900.00 |