RAC3 (NM_005052) Human Mass Spec Standard
CAT#: PH303325
RAC3 MS Standard C13 and N15-labeled recombinant protein (NP_005043)
View other "RAC3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAC3 MS Standard C13 and N15-labeled recombinant protein (NP_005043) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203325 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC203325 protein sequence
Red=Cloning site Green=Tags(s) MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005043 |
RefSeq Size | 1077 |
RefSeq ORF | 576 |
Locus ID | 5881 |
Cytogenetics | 17q25.3 |
Summary | The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Axon guidance, B cell receptor signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401565 | RAC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401565 | Transient overexpression lysate of ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) (RAC3) |
CNY 3,080.00 |
|
TP303325 | Recombinant protein of human ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) (RAC3), 20 µg |
CNY 2,900.00 |