hnRNP A1 (HNRNPA1) (NM_002136) Human Mass Spec Standard
CAT#: PH303314
HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_002127)
View other "hnRNP A1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_002127) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203314 |
Predicted MW | 34.2 kDa |
Protein Sequence |
>RC203314 protein sequence
Red=Cloning site Green=Tags(s) MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDA AMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDR GSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGF GGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGN FGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002127 |
RefSeq Size | 1785 |
RefSeq ORF | 960 |
Synonyms | ALS19; ALS20; hnRNP-A1; hnRNP A1; HNRPA1; HNRPA1L3; IBMPFD3; UP 1 |
Locus ID | 3178 |
Cytogenetics | 12q13.13 |
Summary | This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400778 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC410582 | HNRNPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400778 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1 |
CNY 3,080.00 |
|
LY410582 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2 |
CNY 3,080.00 |
|
PH311626 | HNRNPA1 MS Standard C13 and N15-labeled recombinant protein (NP_112420) |
CNY 19,520.00 |
|
TP303314 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311626 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它hnRNP A1产品