MAD2 (MAD2L1) (NM_002358) Human Mass Spec Standard
CAT#: PH303273
MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349)
View other "MAD2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203273 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC203273 protein sequence
Red=Cloning site Green=Tags(s) MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002349 |
RefSeq Size | 1453 |
RefSeq ORF | 615 |
Synonyms | HSMAD2; MAD2 |
Locus ID | 4085 |
Cytogenetics | 4q27 |
Summary | MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400849 | MAD2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400849 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1) |
CNY 3,080.00 |
|
TP303273 | Recombinant protein of human MAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1), 20 µg |
CNY 2,900.00 |