BANF1 (NM_003860) Human Mass Spec Standard
CAT#: PH303270
BANF1 MS Standard C13 and N15-labeled recombinant protein (NP_003851)
View other "BANF1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BANF1 MS Standard C13 and N15-labeled recombinant protein (NP_003851) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203270 |
Predicted MW | 10.1 kDa |
Protein Sequence |
>RC203270 protein sequence
Red=Cloning site Green=Tags(s) MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN AKQSRDCFGCLREWCDAFL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003851 |
RefSeq Size | 1179 |
RefSeq ORF | 267 |
Synonyms | BAF; BCRP1; D14S1460; NGPS |
Locus ID | 8815 |
Cytogenetics | 11q13.1 |
Summary | The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Jan 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401269 | BANF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428445 | BANF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401269 | Transient overexpression lysate of barrier to autointegration factor 1 (BANF1), transcript variant 1 |
CNY 3,080.00 |
|
LY428445 | Transient overexpression lysate of barrier to autointegration factor 1 (BANF1), transcript variant 2 |
CNY 3,080.00 |
|
TP303270 | Recombinant protein of human barrier to autointegration factor 1 (BANF1), transcript variant 1, 20 µg |
CNY 2,900.00 |