CD36 (NM_000072) Human Mass Spec Standard
CAT#: PH303254
CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063)
View other "CD36" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_000063) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203254 |
Predicted MW | 53.1 kDa |
Protein Sequence |
>RC203254 protein sequence
Red=Cloning site Green=Tags(s) MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDV QNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNL AVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADG VYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFE SDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYAS PDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETG TIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000063 |
RefSeq Size | 2108 |
RefSeq ORF | 1416 |
Synonyms | BDPLT10; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3 |
Locus ID | 948 |
Cytogenetics | 7q21.11 |
Summary | The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, ECM-receptor interaction, Hematopoietic cell lineage, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400018 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424372 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC424373 | CD36 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400018 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3 |
CNY 3,080.00 |
|
LY424372 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 2 |
CNY 4,840.00 |
|
LY424373 | Transient overexpression lysate of CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1 |
CNY 4,840.00 |
|
PH321976 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001001548) |
CNY 14,250.00 |
|
PH325799 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120915) |
CNY 14,250.00 |
|
PH325800 | CD36 MS Standard C13 and N15-labeled recombinant protein (NP_001120916) |
CNY 14,250.00 |
|
TP303254 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP321976 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325799 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP325800 | Purified recombinant protein of Homo sapiens CD36 molecule (thrombospondin receptor) (CD36), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP710013 | Recombinant protein of human CD36 molecule (thrombospondin receptor) (CD36),full length,with C-terminal polyhistidine tag, expressed in sf9 cell |
CNY 4,020.00 |