RNF166 (NM_178841) Human Mass Spec Standard
CAT#: PH303224
RNF166 MS Standard C13 and N15-labeled recombinant protein (NP_849163)
View other "RNF166" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RNF166 MS Standard C13 and N15-labeled recombinant protein (NP_849163) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203224 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC203224 protein sequence
Red=Cloning site Green=Tags(s) MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCP LCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPI PSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFLQHLLHRHKF SYDTFVDYSIDEEAAFQAALALSLSEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_849163 |
RefSeq Size | 1888 |
RefSeq ORF | 711 |
Locus ID | 115992 |
Cytogenetics | 16q24.2-q24.3 |
Summary | E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates (PubMed:27880896). In turn, participates in different biological processes including interferon production or autophagy (PubMed:26456228, PubMed:27880896). Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6 (PubMed:26456228). Plays also a role in the early recruitment of autophagy adapters to bacteria (PubMed:27880896). Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication (PubMed:27880896).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405857 | RNF166 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405857 | Transient overexpression lysate of ring finger protein 166 (RNF166), transcript variant 1 |
CNY 3,080.00 |
|
TP303224 | Recombinant protein of human ring finger protein 166 (RNF166), 20 µg |
CNY 2,900.00 |