STK25 (NM_006374) Human Mass Spec Standard
CAT#: PH303215
STK25 MS Standard C13 and N15-labeled recombinant protein (NP_006365)
View other "STK25" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | STK25 MS Standard C13 and N15-labeled recombinant protein (NP_006365) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203215 |
Predicted MW | 48.1 kDa |
Protein Sequence |
>RC203215 protein sequence
Red=Cloning site Green=Tags(s) MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVL SQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRD IKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAK GEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFL TELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVK RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN HLTSTR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006365 |
RefSeq Size | 2527 |
RefSeq ORF | 1278 |
Synonyms | SOK1; YSK1 |
Locus ID | 10494 |
Cytogenetics | 2q37.3 |
Summary | This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and morphology of the Golgi apparatus. The protein is translocated from the Golgi apparatus to the nucleus in response to chemical anoxia and plays a role in regulation of cell death. A pseudogene associated with this gene is located on chromosome 18. Multiple alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416683 | STK25 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416683 | Transient overexpression lysate of serine/threonine kinase 25 (STE20 homolog, yeast) (STK25) |
CNY 3,080.00 |
|
TP303215 | Purified recombinant protein of Homo sapiens serine/threonine kinase 25 (STE20 homolog, yeast) (STK25), 20 µg |
CNY 2,900.00 |
|
TP761296 | Purified recombinant protein of Human serine/threonine kinase 25 (STK25), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |