HES6 (NM_018645) Human Mass Spec Standard
CAT#: PH303205
HES6 MS Standard C13 and N15-labeled recombinant protein (NP_061115)
View other "HES6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HES6 MS Standard C13 and N15-labeled recombinant protein (NP_061115) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203205 |
Predicted MW | 24.1 kDa |
Protein Sequence |
>RC203205 protein sequence
Red=Cloning site Green=Tags(s) MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS LTTAQIARSVWRPW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061115 |
RefSeq Size | 1470 |
RefSeq ORF | 672 |
Synonyms | bHLHb41; bHLHc23; C-HAIRY1; HES-6 |
Locus ID | 55502 |
Cytogenetics | 2q37.3 |
Summary | This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encoded by this gene functions as a cofactor, interacting with other transcription factors through a tetrapeptide domain in its C-terminus. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412988 | HES6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428288 | HES6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412988 | Transient overexpression lysate of hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1 |
CNY 3,080.00 |
|
LY428288 | Transient overexpression lysate of hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 2 |
CNY 3,080.00 |
|
TP303205 | Recombinant protein of human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1, 20 µg |
CNY 2,900.00 |