Cystatin A (CSTA) (NM_005213) Human Mass Spec Standard
CAT#: PH303115
CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204)
View other "Cystatin A" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CSTA MS Standard C13 and N15-labeled recombinant protein (NP_005204) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203115 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC203115 protein sequence
Red=Cloning site Green=Tags(s) MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF KSLPGQNEDLVLTGYQVDKNKDDELTGF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005204 |
RefSeq Size | 838 |
RefSeq ORF | 294 |
Synonyms | AREI; PSS4; STF1; STFA |
Locus ID | 1475 |
Cytogenetics | 3q21.1 |
Summary | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401596 | CSTA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401596 | Transient overexpression lysate of cystatin A (stefin A) (CSTA) |
CNY 3,080.00 |
|
TP303115 | Recombinant protein of human cystatin A (stefin A) (CSTA), 20 µg |
CNY 2,900.00 |
|
TP720597 | Purified recombinant protein of Human cystatin A (stefin A) (CSTA) |
CNY 3,140.00 |
其它Cystatin A产品