RPL35 (NM_007209) Human Mass Spec Standard
CAT#: PH303088
RPL35 MS Standard C13 and N15-labeled recombinant protein (NP_009140)
View other "RPL35" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RPL35 MS Standard C13 and N15-labeled recombinant protein (NP_009140) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203088 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC203088 protein sequence
Red=Cloning site Green=Tags(s) MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLR KFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVRA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009140 |
RefSeq Size | 475 |
RefSeq ORF | 369 |
Synonyms | DBA19; L35 |
Locus ID | 11224 |
Cytogenetics | 9q33.3 |
Summary | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L29P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ribosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416124 | RPL35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416124 | Transient overexpression lysate of ribosomal protein L35 (RPL35) |
CNY 3,080.00 |
|
TP303088 | Recombinant protein of human ribosomal protein L35 (RPL35), 20 µg |
CNY 2,900.00 |