COMMD9 (NM_014186) Human Mass Spec Standard
CAT#: PH303050
COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905)
View other "COMMD9" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203050 |
Predicted MW | 21.8 kDa |
Protein Sequence |
>RC203050 protein sequence
Red=Cloning site Green=Tags(s) MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRL VAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSIS RMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054905 |
RefSeq Size | 3006 |
RefSeq ORF | 594 |
Synonyms | C11orf55; HSPC166; LINC00610 |
Locus ID | 29099 |
Cytogenetics | 11p13 |
Summary | May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966). Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits (PubMed:23637203).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415448 | COMMD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420318 | COMMD9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415448 | Transient overexpression lysate of COMM domain containing 9 (COMMD9), transcript variant 1 |
CNY 3,080.00 |
|
LY420318 | Transient overexpression lysate of COMM domain containing 9 (COMMD9), transcript variant 2 |
CNY 3,080.00 |
|
TP303050 | Recombinant protein of human COMM domain containing 9 (COMMD9), transcript variant 1, 20 µg |
CNY 2,900.00 |