Vitronectin (VTN) (NM_000638) Human Mass Spec Standard
CAT#: PH302929
VTN MS Standard C13 and N15-labeled recombinant protein (NP_000629)
View other "Vitronectin" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | VTN MS Standard C13 and N15-labeled recombinant protein (NP_000629) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202929 |
Predicted MW | 54.3 kDa |
Protein Sequence |
>RC202929 protein sequence
Red=Cloning site Green=Tags(s) MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM PEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPE TLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAF TRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYW EYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAM AGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDY RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000629 |
RefSeq Size | 1678 |
RefSeq ORF | 1434 |
Synonyms | V75; VN; VNT |
Locus ID | 7448 |
Cytogenetics | 17q11.2 |
Summary | The protein encoded by this gene functions in part as an adhesive glycoprotein. Differential expression of this protein can promote either cell adhesion or migration as it links cells to the extracellular matrix through a variety of ligands. These ligands include integrins, plasminogen activator inhibitor-1, and urokinase plasminogen activator receptor. This secreted protein can be present in the plasma as a monomer or dimer and forms a multimer in the extracellular matrix of several tissues. This protein also inhibits the membrane-damaging effect of the terminal cytolytic complement pathway and binds to several serpin serine protease inhibitors. This protein can also promote extracellular matrix degradation and thus plays a role in tumorigenesis. It is involved in a variety of other biological processes such as the regulation of the coagulation pathway, wound healing, and tissue remodeling. The heparin-binding domain of this protein give it anti-microbial properties. It is also a lipid binding protein that forms a principal component of high density lipoprotein. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | ECM-receptor interaction, Focal adhesion |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400215 | VTN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400215 | Transient overexpression lysate of vitronectin (VTN) |
CNY 3,080.00 |
|
TP302929 | Recombinant protein of human vitronectin (VTN), 20 µg |
CNY 2,900.00 |
|
TP720655 | Purified recombinant protein of Human vitronectin (VTN) |
CNY 3,140.00 |
|
TP750077 | Purified recombinant protein of Human vitronectin (VTN), esidues 62-478aa, Tag free, expressed in E.coli, 50ug |
CNY 2,000.00 |
|
TP790066 | Purified recombinant protein of Human vitronectin (VTN), esidues 20-478aa, with N-terminal HIS tag, secretory expressed in HEK293, 50ug |
CNY 5,070.00 |
其它Vitronectin产品