Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Mass Spec Standard
CAT#: PH302924
NFE2 MS Standard C13 and N15-labeled recombinant protein (NP_006154)
View other "Nuclear Factor Erythroid Derived 2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NFE2 MS Standard C13 and N15-labeled recombinant protein (NP_006154) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202924 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC202924 protein sequence
Red=Cloning site Green=Tags(s) MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY ALQQAADGTIFLVPRGTKMEATD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006154 |
RefSeq Size | 1697 |
RefSeq ORF | 1119 |
Synonyms | NF-E2; p45 |
Locus ID | 4778 |
Cytogenetics | 12q13.13 |
Summary | Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401856 | NFE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427772 | NFE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401856 | Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 1 |
CNY 3,080.00 |
|
LY427772 | Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2 |
CNY 3,080.00 |
|
TP302924 | Recombinant protein of human nuclear factor (erythroid-derived 2), 45kDa (NFE2), 20 µg |
CNY 2,900.00 |
|
TP761189 | Purified recombinant protein of Human nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Nuclear Factor Erythroid Derived 2产品