Nuclear Factor Erythroid Derived 2 (NFE2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NFE2 antibody: synthetic peptide directed towards the N terminal of human NFE2. Synthetic peptide located within the following region: MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	nuclear factor, erythroid 2
Database Link	NP_006154 Entrez Gene 4778 Human UniProt ID Q16621
Background	NFE2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. NFE2 binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. NFE2 is requires MAFK or other small MAF proteins for binding to the NF-E2 motif. NFE2 may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.
Synonyms	NF-E2; p45
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Bovine: 92%; Pig: 87%; Horse: 87%; Guinea pig: 87%; Mouse: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.