DLK (DLK1) (NM_003836) Human Mass Spec Standard
CAT#: PH302923
DLK1 MS Standard C13 and N15-labeled recombinant protein (NP_003827)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DLK1 MS Standard C13 and N15-labeled recombinant protein (NP_003827) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202923 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC202923 protein sequence
Red=Cloning site Green=Tags(s) MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGE PGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQH GGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVT NCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQP EHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLL LQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003827 |
RefSeq Size | 1599 |
RefSeq ORF | 1149 |
Synonyms | Delta1; DLK; DLK-1; FA1; pG2; Pref-1; PREF1; ZOG |
Locus ID | 8788 |
Cytogenetics | 14q32.2 |
Summary | This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is located in a region of chromosome 14 frequently showing unparental disomy, and is imprinted and expressed from the paternal allele. A single nucleotide variant in this gene is associated with child and adolescent obesity and shows polar overdominance, where heterozygotes carrying an active paternal allele express the phenotype, while mutant homozygotes are normal. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401257 | DLK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401257 | Transient overexpression lysate of delta-like 1 homolog (Drosophila) (DLK1) |
CNY 3,080.00 |
|
TP302923 | Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1), 20 µg |
CNY 2,900.00 |
|
TP720389 | Recombinant protein of human delta-like 1 homolog (Drosophila) (DLK1) |
CNY 3,140.00 |