United States
Germany
Japan
United Kingdom
China
CD19 (NM_001770) Human Mass Spec Standard
CAT＃: PH302922
CD19 MS Standard C13 and N15-labeled recombinant protein (NP_001761)
View other "CD19" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | CD19 MS Standard C13 and N15-labeled recombinant protein (NP_001761) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202922 |
| Predicted MW | 61.1 kDa |
| Protein Sequence |
>RC202922 protein sequence
Red=Cloning site Green=Tags(s) MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPG LGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRS SEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRG PLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVL WHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGN VLSLPTPTSGLGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSR EATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001761 |
| RefSeq Size | 1965 |
| RefSeq ORF | 1668 |
| Synonyms | B4; CVID3 |
| Locus ID | 930 |
| Cytogenetics | 16p11.2 |
| Summary | This gene encodes a member of the immunoglobulin gene superfamily. Expression of this cell surface protein is restricted to B cell lymphocytes. This protein is a reliable marker for pre-B cells but its expression diminishes during terminal B cell differentiation in antibody secreting plasma cells. The protein has two N-terminal extracellular Ig-like domains separated by a non-Ig-like domain, a hydrophobic transmembrane domain, and a large C-terminal cytoplasmic domain. This protein forms a complex with several membrane proteins including complement receptor type 2 (CD21) and tetraspanin (CD81) and this complex reduces the threshold for antigen-initiated B cell activation. Activation of this B-cell antigen receptor complex activates the phosphatidylinositol 3-kinase signalling pathway and the subsequent release of intracellular stores of calcium ions. This protein is a target of chimeric antigen receptor (CAR) T-cells used in the treatment of lymphoblastic leukemia. Mutations in this gene are associated with the disease common variable immunodeficiency 3 (CVID3) which results in a failure of B-cell differentiation and impaired secretion of immunoglobulins. CVID3 is characterized by hypogammaglobulinemia, an inability to mount an antibody response to antigen, and recurrent bacterial infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2020] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | B cell receptor signaling pathway, Hematopoietic cell lineage, Primary immunodeficiency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400678 | CD19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400678 | Transient overexpression lysate of CD19 molecule (CD19) |
CNY 3,080.00 |
|
| TP302922 | Recombinant protein of human CD19 molecule (CD19), 20 µg |
CNY 2,900.00 |
|
| TP700276 | Purified recombinant protein of human CD19 molecule (CD19), transcript variant 2, with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP700295 | Purified recombinant protein of human CD19 molecule (CD19), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP721364 | Human CD19 Protein (C-Fc) |
CNY 2,450.00 |
|
| TP721365 | Human CD19 Protein (C-Fc-Avi) |
CNY 2,450.00 |
|
| TP721366 | Biotinylated Human CD19 Protein (C-Fc-Avi) |
CNY 3,480.00 |
|
| TP721367 | PE Conjugated Human CD19 Protein (C-Fc) |
CNY 3,480.00 |
|
| TP721368 | APC Conjugated Human CD19 Protein (C-Fc) |
CNY 3,480.00 |
|
| TP762435 | Purified recombinant protein of Human CD19 molecule (CD19), transcript variant 2, Gln314-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
