TSSC3 (PHLDA2) (NM_003311) Human Mass Spec Standard
CAT#: PH302884
PHLDA2 MS Standard C13 and N15-labeled recombinant protein (NP_003302)
View other "TSSC3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PHLDA2 MS Standard C13 and N15-labeled recombinant protein (NP_003302) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202884 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC202884 protein sequence
Red=Cloning site Green=Tags(s) MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP SRPSPQPKPRTP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003302 |
RefSeq Size | 937 |
RefSeq ORF | 456 |
Synonyms | BRW1C; BWR1C; HLDA2; IPL; TSSC3 |
Locus ID | 7262 |
Cytogenetics | 11p15.4 |
Summary | This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418773 | PHLDA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418773 | Transient overexpression lysate of pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
CNY 3,080.00 |
|
TP302884 | Recombinant protein of human pleckstrin homology-like domain, family A, member 2 (PHLDA2), 20 µg |
CNY 2,900.00 |
|
TP720902 | Purified recombinant protein of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2) |
CNY 3,140.00 |