ZNF346 (NM_012279) Human Mass Spec Standard
CAT#: PH302856
ZNF346 MS Standard C13 and N15-labeled recombinant protein (NP_036411)
View other "ZNF346" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ZNF346 MS Standard C13 and N15-labeled recombinant protein (NP_036411) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202856 |
Predicted MW | 32.9 kDa |
Protein Sequence |
>RC202856 protein sequence
Red=Cloning site Green=Tags(s) MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM QRQPIQKDSTTLED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036411 |
RefSeq Size | 3089 |
RefSeq ORF | 882 |
Synonyms | JAZ; Zfp346 |
Locus ID | 23567 |
Cytogenetics | 5q35.2 |
Summary | The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. It plays a role in protecting neurons by inhibiting cell cycle re-entry via stimulation of p21 gene expression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415847 | ZNF346 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415847 | Transient overexpression lysate of zinc finger protein 346 (ZNF346) |
CNY 3,080.00 |
|
TP302856 | Recombinant protein of human zinc finger protein 346 (ZNF346), 20 µg |
CNY 2,900.00 |