Carboxypeptidase B2 (CPB2) (NM_001872) Human Mass Spec Standard
CAT#: PH302800
CPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001863)
View other "Carboxypeptidase B2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001863) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202800 |
Predicted MW | 48.4 kDa |
Protein Sequence |
>RC202800 protein sequence
Red=Cloning site Green=Tags(s) MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHF FVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERH PDMLTKIHIGSSFEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTN LLRLVDFYVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCG LYPESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKTSKN TRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVI RNV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001863 |
RefSeq Size | 1766 |
RefSeq ORF | 1269 |
Synonyms | CPU; PCPB; TAFI |
Locus ID | 1361 |
Cytogenetics | 13q14.13 |
Summary | Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). The protein encoded by this gene is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis. Polymorphisms have been described for this gene and its promoter region. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414007 | CPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419700 | CPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414007 | Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 2 |
CNY 3,080.00 |
|
LY419700 | Transient overexpression lysate of carboxypeptidase B2 (plasma) (CPB2), transcript variant 1 |
CNY 3,080.00 |
|
TP302800 | Recombinant protein of human carboxypeptidase B2 (plasma) (CPB2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Carboxypeptidase B2产品