IMPA1 (NM_005536) Human Mass Spec Standard
CAT#: PH302784
IMPA1 MS Standard C13 and N15-labeled recombinant protein (NP_005527)
View other "IMPA1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | IMPA1 MS Standard C13 and N15-labeled recombinant protein (NP_005527) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202784 |
Predicted MW | 30.2 kDa |
Protein Sequence |
>RC202784 protein sequence
Red=Cloning site Green=Tags(s) MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005527 |
RefSeq Size | 3396 |
RefSeq ORF | 831 |
Synonyms | IMP; IMPA; MRT59 |
Locus ID | 3612 |
Cytogenetics | 8q21.13 |
Summary | This gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13. [provided by RefSeq, Dec 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417241 | IMPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428539 | IMPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417241 | Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1 |
CNY 3,080.00 |
|
LY428539 | Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 2 |
CNY 3,080.00 |
|
TP302784 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720208 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 2 |
CNY 3,140.00 |