Metallothionein (MT2A) (NM_005953) Human Mass Spec Standard

Specifications

Product Data
Description	MT2A MS Standard C13 and N15-labeled recombinant protein (NP_005944)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC202748
Predicted MW	6 kDa
Protein Sequence	Sequence Link (showhide) >RC202748 protein sequence Red=Cloning site Green=Tags(s) MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_005944
RefSeq Size	466
RefSeq ORF	183
Synonyms	MT-2; MT-II; MT2
Locus ID	4502
Cytogenetics	16q13
Summary	This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heavy metals in the cell. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. The encoded protein interacts with the protein encoded by the homeobox containing 1 gene in some cell types, controlling intracellular zinc levels, affecting apoptotic and autophagy pathways. Some polymorphisms in this gene are associated with an increased risk of cancer. [provided by RefSeq, Sep 2017]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.