Metallothionein (MT2A) (NM_005953) Human Tagged ORF Clone
CAT#: RC202748
MT2A (Myc-DDK-tagged)-Human metallothionein 2A (MT2A)
ORF Plasmid: tGFP
"NM_005953" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | MT-2; MT-II; MT2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202748 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATCCCAACTGCTCCTGCGCCGCCGGTGACTCCTGCACCTGCGCCGGCTCCTGCAAATGCAAAGAGT GCAAATGCACCTCCTGCAAGAAAAGCTGCTGCTCCTGCTGCCCTGTGGGCTGTGCCAAGTGTGCCCAGGG CTGCATCTGCAAAGGGGCGTCGGACAAGTGCAGCTGCTGCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202748 protein sequence
Red=Cloning site Green=Tags(s) MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005953 |
ORF Size | 183 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005953.5 |
RefSeq Size | 466 bp |
RefSeq ORF | 186 bp |
Locus ID | 4502 |
UniProt ID | P02795 |
MW | 6 kDa |
Gene Summary | This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions, altering the intracellular concentration of heavy metals in the cell. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. The encoded protein interacts with the protein encoded by the homeobox containing 1 gene in some cell types, controlling intracellular zinc levels, affecting apoptotic and autophagy pathways. Some polymorphisms in this gene are associated with an increased risk of cancer. [provided by RefSeq, Sep 2017] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Cannabidiol‐induced activation of the metallothionein pathway impedes anticancer effects of disulfiram and its metabolite CuET
,null,
Molecular Oncology
,PubMed ID 34632694
[Metallothionein]
|
Metallothioneins regulate ATP7A trafficking and control cell viability during copper deficiency and excess
,Gudekar, N;Shanbhag, V;Wang, Y;Ralle, M;Weisman, GA;Petris, MJ;,
Sci Rep
,PubMed ID 32398691
[Metallothionein]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202748L1 | Lenti ORF clone of Human metallothionein 2A (MT2A), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202748L2 | Lenti ORF clone of Human metallothionein 2A (MT2A), mGFP tagged |
CNY 5,890.00 |
|
RC202748L3 | Lenti ORF clone of Human metallothionein 2A (MT2A), Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202748L4 | Lenti ORF clone of Human metallothionein 2A (MT2A), mGFP tagged |
CNY 3,600.00 |
|
RG202748 | MT2A (tGFP-tagged) - Human metallothionein 2A (MT2A) |
CNY 2,800.00 |
|
SC125000 | MT2A (untagged)-Human metallothionein 2A (MT2A) |
CNY 1,200.00 |
其它Metallothionein产品