HLA-DRB4 (NM_021983) Human Mass Spec Standard
CAT#: PH302743
HLA MS Standard C13 and N15-labeled recombinant protein (NP_068818)
View other "HLA-DRB4" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HLA MS Standard C13 and N15-labeled recombinant protein (NP_068818) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202743 |
Predicted MW | 29.9 kDa |
Protein Sequence |
>RC202743 protein sequence
Red=Cloning site Green=Tags(s) MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYN SDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQH HNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMM SPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068818 |
RefSeq Size | 1193 |
RefSeq ORF | 798 |
Synonyms | DR4; DRB4; HLA-DR4B; HLA-DRB4* |
Locus ID | 3126 |
Cytogenetics | 6p21.3 |
Summary | HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. There are multiple pseudogenes of this gene. [provided by RefSeq, Feb 2020] |
Protein Families | Transmembrane |
Protein Pathways | Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Hematopoietic cell lineage, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402894 | HLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402894 | Transient overexpression lysate of major histocompatibility complex, class II, DR beta 4 (HLA-DRB4) |
CN¥ 3,080.00 |
|
TP302743 | Recombinant protein of human major histocompatibility complex, class II, DR beta 4 (HLA-DRB4), 20 µg |
CN¥ 2,900.00 |
其它HLA-DRB4产品