GLP1 (GCG) (NM_002054) Human Mass Spec Standard
CAT#: PH302717
GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045)
View other "GLP1" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202717 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC202717 protein sequence
Red=Cloning site Green=Tags(s) MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002045 |
RefSeq Size | 1294 |
RefSeq ORF | 540 |
Synonyms | GLP-1; GLP1; GLP2; GRPP |
Locus ID | 2641 |
Cytogenetics | 2q24.2 |
Summary | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419562 | GCG HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419562 | Transient overexpression lysate of glucagon (GCG) |
CN¥ 3,080.00 |
|
TP302717 | Purified recombinant protein of Homo sapiens glucagon (GCG), 20 µg |
CN¥ 2,900.00 |
|
TP720706 | Purified recombinant protein of Human glucagon (GCG) |
CN¥ 1,800.00 |