NDUFA2 (NM_002488) Human Mass Spec Standard
CAT#: PH302715
NDUFA2 MS Standard C13 and N15-labeled recombinant protein (NP_002479)
View other "NDUFA2" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | NDUFA2 MS Standard C13 and N15-labeled recombinant protein (NP_002479) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202715 |
Predicted MW | 10.9 kDa |
Protein Sequence |
>RC202715 protein sequence
Red=Cloning site Green=Tags(s) MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYA FGQETNVPLNNFSADQVTRALENVLSGKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002479 |
RefSeq Size | 726 |
RefSeq ORF | 297 |
Synonyms | B8; CD14; CIB8; MC1DN13 |
Locus ID | 4695 |
Cytogenetics | 5q31.3 |
Summary | The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex 1), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane, and may be involved in regulating complex I activity or its assembly via assistance in redox processes. Mutations in this gene are associated with Leigh syndrome, an early-onset progressive neurodegenerative disorder. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419296 | NDUFA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY419296 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa (NDUFA2) |
CN¥ 3,080.00 |
|
TP302715 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa (NDUFA2), 20 µg |
CN¥ 2,900.00 |